Perspects in astrophysical databases
classification
💻 cs.DB
astro-ph
keywords
dataaccessdatasetsefficiencylargesimplicityachievedadditional
read the original abstract
Astrophysics has become a domain extremely rich of scientific data. Data mining tools are needed for information extraction from such large datasets. This asks for an approach to data management emphasizing the efficiency and simplicity of data access; efficiency is obtained using multidimensional access methods and simplicity is achieved by properly handling metadata. Moreover, clustering and classification techniques on large datasets pose additional requirements in terms of computation and memory scalability and interpretability of results. In this study we review some possible solutions.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.