Pith. sign in

REVIEW 8 cited by

UNICORN: Runtime Provenance-Based Detector for Advanced Persistent Threats

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2001.01525 v2 pith:YUYGS2BL submitted 2020-01-06 cs.CR

UNICORN: Runtime Provenance-Based Detector for Advanced Persistent Threats

classification cs.CR
keywords unicorndetectionsystemadvancedanalysisaptsattackdetector
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
read the original abstract

Advanced Persistent Threats (APTs) are difficult to detect due to their "low-and-slow" attack patterns and frequent use of zero-day exploits. We present UNICORN, an anomaly-based APT detector that effectively leverages data provenance analysis. From modeling to detection, UNICORN tailors its design specifically for the unique characteristics of APTs. Through extensive yet time-efficient graph analysis, UNICORN explores provenance graphs that provide rich contextual and historical information to identify stealthy anomalous activities without pre-defined attack signatures. Using a graph sketching technique, it summarizes long-running system execution with space efficiency to combat slow-acting attacks that take place over a long time span. UNICORN further improves its detection capability using a novel modeling approach to understand long-term behavior as the system evolves. Our evaluation shows that UNICORN outperforms an existing state-of-the-art APT detection system and detects real-life APT scenarios with high accuracy.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 8 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. HunterAgent: Neuro-Symbolic Attack Trace Reconstruction under Anti-Forensics

    cs.CR 2026-05 unverdicted novelty 6.0

    HunterAgent combines LLM hypothesis generation with symbolic verification and cost-bounded graph search to reconstruct attack paths under anti-forensics, reporting 86.1% mean F1 on benchmarks with reduced hallucinations.

  2. GRASP -- Graph-Based Anomaly Detection Through Self-Supervised Classification

    cs.CR 2026-05 unverdicted novelty 6.0

    GRASP detects anomalies in system provenance graphs via self-supervised executable prediction from two-hop neighborhoods, outperforming prior PIDS on DARPA datasets by identifying all documented attacks where behavior...

  3. The Procedural Semantics Gap in Structured CTI: A Measurement-Driven STIX Analysis for APT Emulation

    cs.CR 2025-12 conditional novelty 6.0

    Structured CTI standards like ATT&CK describe adversary actions but lack the ordering, preconditions, and environmental details needed for direct multi-stage emulation, and a translation method can bridge this gap whe...

  4. TGCM: Topic-Guided Generative Disentanglement of Interleaved APT Technique Sequences

    cs.CR 2026-06 unverdicted novelty 5.0

    TGCM applies consistency models with ATT&CK-derived topic priors to solve unknown-K interleaved sequence demixing for concurrent APT campaigns.

  5. GenAI-Driven Threat Detection with Microsoft Security Copilot

    cs.CR 2026-05 unverdicted novelty 5.0

    DTDA is an LLM-powered autonomous agent that investigates Microsoft Defender incidents via planner-executor loops and generates novel alerts, achieving 80.1% precision in 120-day production use and 0.78 F1 offline.

  6. GenAI-Driven Threat Detection with Microsoft Security Copilot

    cs.CR 2026-05 unverdicted novelty 5.0

    DTDA is an LLM agent that produces novel security alerts at 80.1% customer-validated precision and 0.78 F1 on hidden activity while running at production scale inside Microsoft Defender.

  7. PhishSigma++: Malicious Email Detection with Typed Entity Relations

    cs.CR 2026-05 unverdicted novelty 5.0

    PhishSigma++ reaches 0.9675 F1 on clean data and holds 0.9579 F1 under adversarial text padding by modeling typed entity relations in emails, outperforming text-only baselines that drop sharply.

  8. No Data? No Problem: Synthesizing Security Graphs for Better Intrusion Detection

    cs.CR 2025-06 unverdicted novelty 5.0

    PROVSYN synthesizes high-fidelity security provenance graphs via graph generation and LLMs to augment imbalanced datasets, improving downstream APT detection accuracy by up to 38% on benchmarks.