AMix-2: Establishing Protein as a Native Modality in Large Language Models
Pith reviewed 2026-06-28 20:02 UTC · model grok-4.3
The pith
AMix-2 unifies protein understanding and design in one foundation model by sharing token space with text and using block-wise diffusion modeling.
A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.
Core claim
AMix-2 establishes protein as a native modality in large language models by unifying protein understanding and sequence design within a single foundation model via a unified protein-text formulation and a block-wise diffusion language modeling backbone that combines causal generation across blocks with bidirectional context and iterative refinement within blocks.
What carries the argument
Block-wise diffusion language modeling backbone that enables causal generation across blocks while allowing bidirectional context and iterative refinement within each block, paired with a shared token space for protein sequences and text.
If this is right
- One foundation model can replace multiple task-specific protein models for both understanding and design tasks.
- Generation order flexibility from diffusion better suits the non-sequential nature of protein folding and function than strict autoregression.
- Time-aware and homology-aware evaluation protocols reveal whether models truly generalize beyond training data patterns.
- Controlled comparisons confirm that diffusion-based training outperforms autoregressive training on protein tasks.
Where Pith is reading between the lines
- This setup might allow direct text-to-protein generation for applications like custom enzyme design without separate pipelines.
- The approach could extend to other sequence modalities such as DNA or RNA in the same model.
- ProteinArena may serve as a standard testbed for future protein foundation models to ensure fair comparisons.
- Scaling the shared modality to larger models could lead to emergent capabilities in multi-step biological reasoning.
Load-bearing premise
Embedding natural language and protein sequences in a shared token space plus using block-wise diffusion rather than strict autoregressive factorization will produce performance on realistic generalization tasks that cannot be explained by training data or benchmark choices alone.
What would settle it
Training an autoregressive version of the same model on identical data and showing it matches or exceeds AMix-2 performance on ProteinArena under the time-aware and homology-aware splits.
read the original abstract
We present AMix-2, a protein-text foundation model that establishes protein as a native modality in large language models (LLMs), unifying protein understanding and sequence design within a single foundation model. AMix-2 is built upon two key ideas: (1) a unified protein-text formulation that embeds natural language and protein sequence in a shared token space, enabling one model to perform biological reasoning and conditional design instead of separate downstream task-specialized models; and (2) a block-wise diffusion language modeling backbone that combines causal generation across blocks with bidirectional context and iterative refinement within blocks. This scheme better matches the intrinsic nature of proteins than a strict left-to-right factorization. To evaluate protein foundation models under realistic generalization settings, we further introduce ProteinArena, a comprehensive benchmark with time-aware and homology-aware protocols across various understanding and design tasks, and with baselines covering classical bioinformatics tools, protein-specialized models and LLMs. On ProteinArena, AMix-2 outperforms frontier LLMs and demonstrates competitive performance to task-specific protein models. Controlled experiments further show that the diffusion-based paradigm generally surpasses its autoregressive counterpart, highlighting the advantage of flexible generation order for protein sequences. We release both AMix-2 and ProteinArena to facilitate open research in protein foundation models.
Editorial analysis
A structured set of objections, weighed in public.
Referee Report
Summary. The manuscript presents AMix-2, a protein-text foundation model that establishes protein as a native modality in LLMs by unifying protein understanding and sequence design within a single model. It relies on a unified protein-text formulation embedding natural language and protein sequences in a shared token space, combined with a block-wise diffusion language modeling backbone that enables causal generation across blocks with bidirectional context and iterative refinement within blocks. The work introduces ProteinArena, a benchmark with time-aware and homology-aware protocols across understanding and design tasks, and reports that AMix-2 outperforms frontier LLMs while remaining competitive with task-specific protein models; controlled experiments indicate the diffusion paradigm generally surpasses its autoregressive counterpart.
Significance. If the performance claims hold under the stated evaluation protocols, the work would be significant for integrating protein sequences as a native modality in LLMs, enabling a single model for both biological reasoning and conditional design tasks rather than task-specialized models. The introduction of ProteinArena provides a standardized, realistic generalization benchmark, and the open release of both the model and benchmark facilitates reproducibility and community research in protein foundation models.
major comments (2)
- [Abstract] Abstract: the central claim of outperformance on ProteinArena and competitiveness with task-specific models is asserted without any quantitative metrics, ablation tables, error bars, or baseline numbers; this prevents verification of whether the reported advantage survives controls for data splits, homology leakage, or benchmark construction details.
- [Abstract] The weakest assumption—that shared token space plus block-wise diffusion yields generalization not explained by training data or benchmark construction—requires explicit evidence in the results; without reported numbers or controls isolating these factors, the diffusion advantage cannot be confirmed as load-bearing rather than data-dependent.
Simulated Author's Rebuttal
We thank the referee for the constructive feedback on the abstract. We agree that the abstract would be strengthened by including key quantitative results and will revise it accordingly in the next version. We address each major comment below.
read point-by-point responses
-
Referee: [Abstract] Abstract: the central claim of outperformance on ProteinArena and competitiveness with task-specific models is asserted without any quantitative metrics, ablation tables, error bars, or baseline numbers; this prevents verification of whether the reported advantage survives controls for data splits, homology leakage, or benchmark construction details.
Authors: We agree that the abstract currently lacks specific numbers. The main text (Sections 4 and 5, Tables 1-4, and Figure 3) reports the full quantitative results on ProteinArena, including comparisons to baselines, ablations, and controls for time-aware/homology-aware splits. In revision we will add concise performance deltas (e.g., average improvement over frontier LLMs and competitiveness metrics vs. task-specific models) plus a reference to the benchmark protocols directly into the abstract. revision: yes
-
Referee: [Abstract] The weakest assumption—that shared token space plus block-wise diffusion yields generalization not explained by training data or benchmark construction—requires explicit evidence in the results; without reported numbers or controls isolating these factors, the diffusion advantage cannot be confirmed as load-bearing rather than data-dependent.
Authors: The controlled diffusion-vs-autoregressive comparison is presented in Section 4.3 with the same training data and benchmark construction for both paradigms; the results show consistent gains for the block-wise diffusion approach across tasks. We will add a brief clause in the revised abstract that explicitly references these controlled experiments and the ProteinArena protocols (Section 3) to make the supporting evidence visible at the abstract level. revision: yes
Circularity Check
No significant circularity in derivation chain
full rationale
The paper presents AMix-2 as an empirical construction: a shared protein-text token space plus block-wise diffusion backbone, trained and evaluated on the newly introduced ProteinArena benchmark with time/homology-aware splits. No equations, fitted parameters, or self-citations are described that would reduce reported performance or the unification claim to a definition or tautology. The central results are controlled comparisons against external baselines (bioinformatics tools, specialized models, frontier LLMs), making the derivation self-contained rather than circular.
Axiom & Free-Parameter Ledger
Reference graph
Works this paper leans on
-
[1]
Highly accurate protein structure prediction with alphafold.nature, 596(7873):583–589, 2021
John Jumper, Richard Evans, Alexander Pritzel, Tim Green, Michael Figurnov, Olaf Ronneberger, Kathryn Tunyasuvunakool, Russ Bates, Augustin Žídek, Anna Potapenko, et al. Highly accurate protein structure prediction with alphafold.nature, 596(7873):583–589, 2021
2021
-
[2]
Bagal, V ., Aggarwal, R., Vinod, P., and Priyakumar, U
Minkyung Baek, Frank DiMaio, Ivan Anishchenko, Justas Dauparas, Sergey Ovchinnikov, Gyu Rie Lee, Jue Wang, Qian Cong, Lisa N. Kinch, R. Dustin Schaeffer, Claudia Millán, Hahnbeom Park, Carson Adams, Caleb R. Glassman, Andy DeGiovanni, Jose H. Pereira, Andria V. Rodrigues, Alberdina A. van Dijk, Ana C. Ebrecht, Diederik J. Opperman, Theo Sagmeister, Christ...
-
[3]
Robust deep learning–based protein sequence design using proteinmpnn.Science, 378(6615):49–56, 2022
Justas Dauparas, Ivan Anishchenko, Nathaniel Bennett, Hua Bai, Robert J Ragotte, Lukas F Milles, Basile IM Wicky, Alexis Courbet, Rob J de Haas, Neville Bethel, et al. Robust deep learning–based protein sequence design using proteinmpnn.Science, 378(6615):49–56, 2022
2022
-
[4]
De novo design of protein structure and function with rfdiffusion.Nature, 620(7976):1089–1100, 2023
Joseph L Watson, David Juergens, Nathaniel R Bennett, Brian L Trippe, Jason Yim, Helen E Eisenach, Woody Ahern, Andrew J Borst, Robert J Ragotte, Lukas F Milles, et al. De novo design of protein structure and function with rfdiffusion.Nature, 620(7976):1089–1100, 2023
2023
-
[5]
Accurate structure prediction of biomolecular interactions with alphafold 3.Nature, pages 1–3, 2024
Josh Abramson, Jonas Adler, Jack Dunger, Richard Evans, Tim Green, Alexander Pritzel, Olaf Ronneberger, Lindsay Willmore, Andrew J Ballard, Joshua Bambrick, et al. Accurate structure prediction of biomolecular interactions with alphafold 3.Nature, pages 1–3, 2024
2024
-
[6]
Evolutionary-scale prediction of atomic-level protein structure with a language model.Science, 379(6637):1123–1130, 2023
Zeming Lin, Halil Akin, Roshan Rao, Brian Hie, Zhongkai Zhu, Wenting Lu, Nikita Smetanin, Robert Verkuil, Ori Kabeli, Yaniv Shmueli, et al. Evolutionary-scale prediction of atomic-level protein structure with a language model.Science, 379(6637):1123–1130, 2023
2023
-
[7]
Large language models generate functional protein sequences across diverse families.Nature Biotechnology, 41(8):1099–1106, 2023
Ali Madani, Ben Krause, Eric R Greene, Subu Subramanian, Benjamin P Mohr, James M Holton, Jose Luis Olmos, Caiming Xiong, Zachary Z Sun, Richard Socher, et al. Large language models generate functional protein sequences across diverse families.Nature Biotechnology, 41(8):1099–1106, 2023
2023
-
[8]
Saprot: Protein language modeling with structure-aware vocabulary.bioRxiv, pages 2023–10, 2023
Jin Su, Chenchen Han, Yuyang Zhou, Junjie Shan, Xibin Zhou, and Fajie Yuan. Saprot: Protein language modeling with structure-aware vocabulary.bioRxiv, pages 2023–10, 2023
2023
-
[9]
Protrek: Navigating the protein universe through tri-modal contrastive learning.bioRxiv, pages 2024–05, 2024
Jin Su, Xibin Zhou, Xuting Zhang, and Fajie Yuan. Protrek: Navigating the protein universe through tri-modal contrastive learning.bioRxiv, pages 2024–05, 2024
2024
-
[10]
Simulating 500 million years of evolution with a language model
Thomas Hayes, Roshan Rao, Halil Akin, Nicholas J Sofroniew, Deniz Oktay, Zeming Lin, Robert Verkuil, Vincent Q Tran, Jonathan Deaton, Marius Wiggert, et al. Simulating 500 million years of evolution with a language model. Science, 387(6736):850–858, 2025
2025
-
[11]
Basic local alignment search tool.Journal of molecular biology, 215(3):403–410, 1990
Stephen F Altschul, Warren Gish, Webb Miller, Eugene W Myers, and David J Lipman. Basic local alignment search tool.Journal of molecular biology, 215(3):403–410, 1990
1990
-
[12]
Mmseqs2 enables sensitive protein sequence searching for the analysis of massive data sets.Nature biotechnology, 35(11):1026–1028, 2017
Martin Steinegger and Johannes Söding. Mmseqs2 enables sensitive protein sequence searching for the analysis of massive data sets.Nature biotechnology, 35(11):1026–1028, 2017
2017
-
[13]
Fast and accurate protein structure search with foldseek.Nature biotechnology, 42(2):243–246, 2024
Michel Van Kempen, Stephanie S Kim, Charlotte Tumescheit, Milot Mirdita, Jeongjae Lee, Cameron LM Gilchrist, Johannes Söding, and Martin Steinegger. Fast and accurate protein structure search with foldseek.Nature biotechnology, 42(2):243–246, 2024
2024
-
[14]
Zhidian Zhang, Chenxi Ou, Yehlin Cho, Yo Akiyama, and Sergey Ovchinnikov. Artificial intelligence methods for protein folding and design.Current Opinion in Structural Biology, 93:103066, 2025. ISSN 0959-440X. doi: https://doi.org/10.1016/j.sbi.2025.103066. URL https://www.sciencedirect.com/science/article/pii/ S0959440X25000843
-
[15]
Introducing claude 4.https://www.anthropic.com/news/claude-4, 2026
Anthropic. Introducing claude 4.https://www.anthropic.com/news/claude-4, 2026
2026
-
[16]
Gemini 3.1 pro.https://deepmind.google/models/gemini/pro, 2026
Google DeepMind. Gemini 3.1 pro.https://deepmind.google/models/gemini/pro, 2026. 15
2026
-
[17]
Aaditya Singh, Adam Fry, Adam Perelman, Adam Tart, Adi Ganesh, Ahmed El-Kishky, Aidan McLaughlin, Aiden Low, AJ Ostrow, Akhila Ananthram, et al. Openai gpt-5 system card.arXiv preprint arXiv:2601.03267, 2025
work page internal anchor Pith review Pith/arXiv arXiv 2025
-
[18]
Deepseek-v4: Towards highly efficient million-token context intelligence.https://huggingface
DeepSeek AI. Deepseek-v4: Towards highly efficient million-token context intelligence.https://huggingface. co/deepseek-ai/DeepSeek-V4-Pro, 2026
2026
-
[19]
GLM-5: from Vibe Coding to Agentic Engineering
Aohan Zeng, Xin Lv, Zhenyu Hou, Zhengxiao Du, Qinkai Zheng, Bin Chen, Da Yin, Chendi Ge, Chenghua Huang, Chengxing Xie, et al. Glm-5: from vibe coding to agentic engineering.arXiv preprint arXiv:2602.15763, 2026
work page internal anchor Pith review Pith/arXiv arXiv 2026
-
[20]
An Yang, Anfeng Li, Baosong Yang, Beichen Zhang, Binyuan Hui, Bo Zheng, Bowen Yu, Chang Gao, Chengen Huang, Chenxu Lv, Chujie Zheng, Dayiheng Liu, Fan Zhou, Fei Huang, Feng Hu, Hao Ge, Haoran Wei, Huan Lin, Jialong Tang, Jian Yang, Jianhong Tu, Jianwei Zhang, Jianxin Yang, Jiaxi Yang, Jing Zhou, Jingren Zhou, Junyang Lin, Kai Dang, Keqin Bao, Kexin Yang, ...
work page internal anchor Pith review Pith/arXiv arXiv 2025
-
[21]
Biomni: A general-purpose biomedical ai agent.bioRxiv, pages 2025–05, 2025
Kexin Huang, Serena Zhang, Hanchen Wang, Yuanhao Qu, Yingzhou Lu, Yusuf Roohani, Ryan Li, Lin Qiu, Junze Zhang, Yin Di, et al. Biomni: A general-purpose biomedical ai agent.bioRxiv, pages 2025–05, 2025
2025
-
[22]
Stella: Towards a biomedical world model with self-evolving multimodal agents.bioRxiv, 2026
Ruofan Jin, Mingyang Xu, Fei Meng, Guancheng Wan, Qingran Cai, Yize Jiang, Jin Han, Yuanyuan Chen, Wanqing Lu, Mengyang Wang, Zhiqian Lan, Yuxuan Jiang, Junhong Liu, Dongyao Wang, Le Cong, and Zaixi Zhang. Stella: Towards a biomedical world model with self-evolving multimodal agents.bioRxiv, 2025. doi: 10.1101/2025.07.01.662467
-
[23]
Adibvafa Fallahpour, Andrew Magnuson, Purav Gupta, Shihao Ma, Jack Naimer, Arnav Shah, Haonan Duan, Omar Ibrahim, Hani Goodarzi, Chris J. Maddison, and Bo Wang. Bioreason: Incentivizing multimodal biological reasoning within a dna-llm model, 2025. URLhttps://arxiv.org/abs/2505.23579
-
[24]
Alexander Rives, Joshua Meier, Tom Sercu, Siddharth Goyal, Zeming Lin, Jason Liu, Demi Guo, Myle Ott, C Lawrence Zitnick, Jerry Ma, et al. Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences.Proceedings of the National Academy of Sciences, 118(15):e2016239118, 2021
2021
-
[25]
Msa transformer
Roshan M Rao, Jason Liu, Robert Verkuil, Joshua Meier, John Canny, Pieter Abbeel, Tom Sercu, and Alexander Rives. Msa transformer. InInternational Conference on Machine Learning, pages 8844–8856. PMLR, 2021
2021
-
[26]
Transformer protein language models are unsupervised structure learners
Roshan Rao, Joshua Meier, Tom Sercu, Sergey Ovchinnikov, and Alexander Rives. Transformer protein language models are unsupervised structure learners. InInternational Conference on Learning Representations, 2021. URLhttps://openreview.net/forum?id=fylclEqgvgd
2021
-
[27]
arXiv preprint arXiv:2402.18567 , year=
Xinyou Wang, Zaixiang Zheng, Fei Ye, Dongyu Xue, Shujian Huang, and Quanquan Gu. Diffusion language models are versatile protein learners.arXiv preprint arXiv:2402.18567, 2024
-
[28]
Block Diffusion: Interpolating Between Autoregressive and Diffusion Language Models
Marianne Arriola, Aaron Gokaslan, Justin T Chiu, Zhihan Yang, Zhixuan Qi, Jiaqi Han, Subham Sekhar Sahoo, and Volodymyr Kuleshov. Block diffusion: Interpolating between autoregressive and diffusion language models. InThe Thirteenth International Conference on Learning Representations, 2025. URL https: //arxiv.org/abs/2503.09573
work page internal anchor Pith review Pith/arXiv arXiv 2025
-
[29]
Seed Diffusion: A Large-Scale Diffusion Language Model with High-Speed Inference
Yuxuan Song, Zheng Zhang, Cheng Luo, Pengyang Gao, Fan Xia, Hao Luo, Zheng Li, Yuehang Yang, Hongli Yu, Xingwei Qu, Yuwei Fu, Jing Su, Ge Zhang, Wenhao Huang, Mingxuan Wang, Lin Yan, Xiaoying Jia, Jingjing Liu, Wei-Ying Ma, Ya-Qin Zhang, Yonghui Wu, and Hao Zhou. Seed diffusion: A large-scale diffusion language model with high-speed inference, 2025. URLht...
work page internal anchor Pith review Pith/arXiv arXiv 2025
-
[30]
UniProt : the U niversal P rotein K nowledgebase in 2023
The UniProt Consortium. Uniprot: the universal protein knowledgebase in 2023.Nucleic Acids Research, 51 (D1):D523–D531, 01 2023. ISSN 0305-1048. doi: 10.1093/nar/gkac1052. URLhttps://doi.org/10.1093/nar/ gkac1052
-
[31]
Care: a benchmark suite for the classification and retrieval of enzymes.Advances in Neural Information Processing Systems, 37:3094–3121, 2024
Jason Yang, Ariane Mora, Shengchao Liu, Bruce J Wittmann, Anima Anandkumar, Frances H Arnold, and Yisong Yue. Care: a benchmark suite for the classification and retrieval of enzymes.Advances in Neural Information Processing Systems, 37:3094–3121, 2024. 16
2024
-
[32]
Vaishali P Waman, Nicola Bordin, Andy Lau, Shaun Kandathil, Jude Wells, David Miller, Sameer Velankar, David T Jones, Ian Sillitoe, and Christine Orengo. Cath v4. 4: major expansion of cath by experimental and predicted structural data.Nucleic Acids Research, 53(D1):D348–D355, 2025
2025
-
[33]
Pdfbench: A benchmark for de novo protein design from function.arXiv preprint arXiv:2505.20346, 2025
Jiahao Kuang, Nuowei Liu, Jie Wang, Changzhi Sun, Tao Ji, and Yuanbin Wu. Pdfbench: A benchmark for de novo protein design from function.arXiv preprint arXiv:2505.20346, 2025
-
[34]
Qizhi Pei, Zhimeng Zhou, Kaiyuan Gao, Jinhua Zhu, Yue Wang, Zun Wang, Tao Qin, Lijun Wu, and Rui Yan. Leveraging biomolecule and natural language through multi-modal learning: A survey, 2025. URL https://arxiv.org/abs/2403.01528
-
[35]
Clustering huge protein sequence sets in linear time
M Steinegger and J Söding. Clustering huge protein sequence sets in linear time. nat commun 9: 2542, 2018
2018
-
[36]
Interpro: the protein sequence classification resource in 2025.Nucleic acids research, 53(D1):D444–D456, 2025
Matthias Blum, Antonina Andreeva, Laise Cavalcanti Florentino, Sara Rocio Chuguransky, Tiago Grego, Emma Hobbs, Beatriz Lazaro Pinto, Ailsa Orr, Typhaine Paysan-Lafosse, Irina Ponamareva, et al. Interpro: the protein sequence classification resource in 2025.Nucleic acids research, 53(D1):D444–D456, 2025
2025
-
[37]
Martin, Karine Michoud, Claire O’Donovan, Isabelle Phan, Sandrine Pilbout, and Michel Schneider
Brigitte Boeckmann, Amos Bairoch, Rolf Apweiler, Marie-Claude Blatter, Anne Estreicher, Elisabeth Gasteiger, Maria J. Martin, Karine Michoud, Claire O’Donovan, Isabelle Phan, Sandrine Pilbout, and Michel Schneider. The swiss-prot protein knowledgebase and its supplement trembl in 2003.Nucleic Acids Research, 31(1):365–370, 01 2003. ISSN 0305-1048. doi: 10...
-
[38]
Johnson, Jonathan Ho, Daniel Tarlow, and Rianne van den Berg
Jacob Austin, Daniel D. Johnson, Jonathan Ho, Daniel Tarlow, and Rianne van den Berg. Structured denoising diffusion models in discrete state-spaces. InAdvances in Neural Information Processing Systems, 2021
2021
-
[39]
Large Language Diffusion Models
Shen Nie, Fengqi Zhu, Zebin You, Xiaolu Zhang, Jingyang Ou, Jun Hu, Jun Zhou, Yankai Lin, Ji-Rong Wen, and Chongxuan Li. Large language diffusion models.arXiv preprint arXiv:2502.09992, 2025
work page internal anchor Pith review Pith/arXiv arXiv 2025
-
[40]
Simple and effective masked diffusion language models
Subham Sekhar Sahoo, Marianne Arriola, Aaron Gokaslan, Edgar Mariano Marroquin, Alexander M Rush, Yair Schiff, Justin T Chiu, and Volodymyr Kuleshov. Simple and effective masked diffusion language models. InThe Thirty-eighth Annual Conference on Neural Information Processing Systems, 2024. URL https://openreview.net/forum?id=L4uaAR4ArM
2024
-
[41]
Jinsong Li, Xiaoyi Dong, Yuhang Zang, Yuhang Cao, Jiaqi Wang, and Dahua Lin. Beyond fixed: Training-free variable-length denoising for diffusion large language models.arXiv preprint arXiv:2508.00819, 2025
-
[42]
Sarah Alamdari, Nitya Thakkar, Rianne van den Berg, Neil Tenenholtz, Robert Strome, Alan M. Moses, Alex X. Lu, Nicolò Fusi, Ava P. Amini, and Kevin K. Yang. Protein generation with evolutionary diffusion: sequence is all you need.bioRxiv, 2024. doi: 10.1101/2023.09.11.556673. URL https://www.biorxiv.org/content/early/ 2024/11/04/2023.09.11.556673
-
[43]
Jiaxin Shi, Kehang Han, Zhe Wang, Arnaud Doucet, and Michalis K. Titsias. Simplified and generalized masked diffusion for discrete data. InAdvances in Neural Information Processing Systems, 2024
2024
-
[44]
Your absorbing discrete diffusion secretly models the conditional distributions of clean data, 2024
Jingyang Ou, Shen Nie, Kaiwen Xue, Fengqi Zhu, Jiacheng Sun, Zhenguo Li, and Chongxuan Li. Your absorbing discrete diffusion secretly models the conditional distributions of clean data, 2024
2024
-
[45]
Marks, Lucy J
Debora S. Marks, Lucy J. Colwell, Robert Sheridan, Thomas A. Hopf, Andrea Pagnani, Riccardo Zecchina, and Chris Sander. Protein 3d structure computed from evolutionary sequence variation.PLOS ONE, 6(12):1–20, 12
-
[46]
URLhttps://doi.org/10.1371/journal.pone.0028766
doi: 10.1371/journal.pone.0028766. URLhttps://doi.org/10.1371/journal.pone.0028766
-
[47]
Evaluating protein transfer learning with tape
Roshan Rao, Nicholas Bhattacharya, Neil Thomas, Yan Duan, Peter Chen, John Canny, Pieter Abbeel, and Yun Song. Evaluating protein transfer learning with tape. In H. Wallach, H. Larochelle, A. Beygelzimer, F. d'Alché-Buc, E. Fox, and R. Garnett, editors,Advances in Neural Information Processing Systems, volume 32. Curran Associates, Inc., 2019
2019
-
[48]
FLIP: Benchmark tasks in fitness landscape inference for proteins
Christian Dallago, Jody Mou, Kadina E Johnston, Bruce Wittmann, Nick Bhattacharya, Samuel Goldman, Ali Madani, and Kevin K Yang. FLIP: Benchmark tasks in fitness landscape inference for proteins. InThirty-fifth Conference on Neural Information Processing Systems Datasets and Benchmarks Track (Round 2), 2021. URLhttps://openreview.net/forum?id=p2dMLEwL8tF
2021
-
[49]
Peer: A comprehensive and multi-task benchmark for protein sequence understanding
Minghao Xu, Zuobai Zhang, Jiarui Lu, Zhaocheng Zhu, Yangtian Zhang, Ma Chang, Runcheng Liu, and Jian Tang. Peer: A comprehensive and multi-task benchmark for protein sequence understanding. In S. Koyejo, S. Mohamed, A. Agarwal, D. Belgrave, K. Cho, and A. Oh, editors,Advances in Neural Information Processing Systems, volume 35, pages 35156–35173. Curran A...
2022
-
[50]
A text-guided pro- tein design framework.Nature Machine Intelligence, 7(4):580–591, March 2025
Shengchao Liu, Yanjing Li, Zhuoxinran Li, Anthony Gitter, Yutao Zhu, Jiarui Lu, Zhao Xu, Weili Nie, Arvind Ramanathan, Chaowei Xiao, Jian Tang, Hongyu Guo, and Anima Anandkumar. A text-guided pro- tein design framework.Nature Machine Intelligence, 7(4):580–591, March 2025. ISSN 2522-5839. doi: 10.1038/s42256-025-01011-z. URLhttp://dx.doi.org/10.1038/s4225...
-
[51]
Ingraham, Max Baranov, Zak Costello, Karl W
John B. Ingraham, Max Baranov, Zak Costello, Karl W. Barber, Wujie Wang, Ahmed Ismail, Vincent Frappier, Dana M. Lord, Christopher Ng-Thow-Hing, Erik R. Van Vlack, Shan Tie, Vincent Xue, Sarah C. Cowles, Alan Leung, João V. Rodrigues, Claudio L. Morales-Perez, Alex M. Ayoub, Robin Green, Katherine Puentes, Frank Oplinger, Nishant V. Panwar, Fritz Obermeye...
-
[52]
doi: 10.1038/s41586-023-06728-8
-
[53]
Jiawei Gu, Xuhui Jiang, Zhichao Shi, Hexiang Tan, Xuehao Zhai, Chengjin Xu, Wei Li, Yinghan Shen, Shengjie Ma, Honghao Liu, Saizhuo Wang, Kun Zhang, Yuanzhuo Wang, Wen Gao, Lionel Ni, and Jian Guo. A survey on llm-as-a-judge, 2025. URLhttps://arxiv.org/abs/2411.15594
work page internal anchor Pith review Pith/arXiv arXiv 2025
-
[54]
Language models of protein sequences at the scale of evolution enable accurate structure prediction.bioRxiv, 2022
Zeming Lin, Halil Akin, Roshan Rao, Brian Hie, Zhongkai Zhu, Wenting Lu, Nikita Smetanin, Allan dos Santos Costa, Maryam Fazel-Zarandi, Tom Sercu, Sal Candido, et al. Language models of protein sequences at the scale of evolution enable accurate structure prediction.bioRxiv, 2022
2022
-
[55]
Ali Madani, Bryan McCann, Nikhil Naik, Nitish Shirish Keskar, Namrata Anand, Raphael R Eguchi, Po-Ssu Huang, and Richard Socher. Progen: Language modeling for protein generation.arXiv preprint arXiv:2004.03497, 2020
-
[56]
Progen2: exploring the boundaries of protein language models.Cell systems, 14(11):968–978, 2023
Erik Nijkamp, Jeffrey A Ruffolo, Eli N Weinstein, Nikhil Naik, and Ali Madani. Progen2: exploring the boundaries of protein language models.Cell systems, 14(11):968–978, 2023
2023
-
[57]
Curran, Alexander M
Aadyot Bhatnagar, Sarthak Jain, Joel Beazer, Samuel C. Curran, Alexander M. Hoffnagle, Kyle Shan Ching, Michael Martyn, Stephen Nayfach, Jeffrey A. Ruffolo, and Ali Madani. Scaling unlocks broader generation and deeper functional understanding of proteins. InThe Thirty-ninth Annual Conference on Neural Information Processing Systems, 2026. URLhttps://open...
2026
-
[58]
arXiv preprint arXiv:2410.13782 , year=
Xinyou Wang, Zaixiang Zheng, Fei Ye, Dongyu Xue, Shujian Huang, and Quanquan Gu. Dplm-2: A multimodal diffusion protein language model.arXiv preprint arXiv:2410.13782, 2024
-
[59]
Elucidating the design space of multimodal protein language models
Cheng-Yen Hsieh, Xinyou Wang, Daiheng Zhang, Dongyu Xue, Fei Ye, Shujian Huang, Zaixiang Zheng, and Quanquan Gu. Elucidating the design space of multimodal protein language models. InInternational Conference on Machine Learning, 2025
2025
-
[60]
Towards A Generative Protein Evolution Machine with DPLM-Evo
Xinyou Wang, Liang Hong, Jiasheng Ye, Zaixiang Zheng, Yu Li, Shujian Huang, and Quanquan Gu. Towards a generative protein evolution machine with dplm-evo, 2026. URLhttps://arxiv.org/abs/2605.00182
work page internal anchor Pith review Pith/arXiv arXiv 2026
-
[61]
Protein design with dynamic protein vocabulary.arXiv preprint arXiv:2505.18966, 2025
Nuowei Liu, Jiahao Kuang, Yanting Liu, Changzhi Sun, Tao Ji, Yuanbin Wu, and Man Lan. Protein design with dynamic protein vocabulary.arXiv preprint arXiv:2505.18966, 2025
-
[62]
Toward de novo protein design from natural language.bioRxiv, 2025
Fengyuan Dai, Shiyang You, Yudian Zhu, Yuan Gao, Lihao Fu, Xibin Zhou, Jin Su, Chentong Wang, Yuliang Fan, Xiaoxiao Ma, Xianjun Deng, Letong Yu, Hui Qian, Yan He, Yitao Ke, Chenchen Han, Xing Chang, Liangzhen Zheng, Sheng Wang, Yajie Wang, Anping Zeng, Shunzhi Wang, Tong Si, Jianming Liu, Hongyuan Lu, and Fajie Yuan. Toward de novo protein design from nat...
-
[63]
Yingce Xia, Peiran Jin, Shufang Xie, Liang He, Chuan Cao, Renqian Luo, Guoqing Liu, Yue Wang, Zequn Liu, Yuan-Jyue Chen, Zekun Guo, Yeqi Bai, Pan Deng, Yaosen Min, Ziheng Lu, Hongxia Hao, Han Yang, Jielan Li, Chang Liu, Jia Zhang, Jianwei Zhu, Ran Bi, Kehan Wu, Wei Zhang, Kaiyuan Gao, Qizhi Pei, Qian Wang, Xixian Liu, Yanting Li, Houtian Zhu, Yeqing Lu, M...
-
[64]
Claude for life sciences
Anthropic. Claude for life sciences. https://www.anthropic.com/news/claude-for-life-sciences, October 2025
2025
-
[65]
Introducing GPT-Rosalind.https://openai.com/index/introducing-gpt-rosalind/, 2026
OpenAI. Introducing GPT-Rosalind.https://openai.com/index/introducing-gpt-rosalind/, 2026. 18
2026
-
[66]
Mihaly Varadi, Damian Bertoni, Paulyna Magana, Urmila Paramval, Ivanna Pidruchna, Malarvizhi Radhakrishnan, Maxim Tsenkov, Sreenath Nair, Milot Mirdita, Jingi Yeo, Oleg Kovalevskiy, Kathryn Tunyasuvunakool, Agata Laydon, Augustin Žídek, Hamish Tomlinson, Dhavanthi Hariharan, Josh Abrahamson, Tim Green, John Jumper, Ewan Birney, Martin Steinegger, Demis Ha...
-
[67]
CFP-gen: Combinatorial functional protein generation via diffusion language models
Junbo Yin, Chao Zha, Wenjia He, Chencheng Xu, and Xin Gao. CFP-gen: Combinatorial functional protein generation via diffusion language models. InForty-second International Conference on Machine Learning,
-
[68]
URLhttps://openreview.net/forum?id=EiM163eZyg
-
[69]
Sean Welleck, Ilia Kulikov, Stephen Roller, Emily Dinan, Kyunghyun Cho, and Jason Weston. Neural text generation with unlikelihood training, 2019. URLhttps://arxiv.org/abs/1908.04319
-
[70]
The UniProt Consortium. Uniprot: the universal protein knowledgebase in 2025.Nucleic Acids Research, 53 (D1):D609–D617, 01 2025. ISSN 1362-4962. doi: 10.1093/nar/gkae1010. URLhttps://doi.org/10.1093/nar/ gkae1010
-
[71]
Quinn, Amaia Sangrador-Vegas, Maxim Scheremetjew, Siew-Yit Yong, Rodrigo Lopez, and Sarah Hunter
Philip Jones, David Binns, Hsin-Yu Chang, Matthew Fraser, Weizhong Li, Craig McAnulla, Hamish McWilliam, John Maslen, Alex Mitchell, Gift Nuka, Sebastien Pesseat, Antony F. Quinn, Amaia Sangrador-Vegas, Maxim Scheremetjew, Siew-Yit Yong, Rodrigo Lopez, and Sarah Hunter. Interproscan 5: genome-scale protein function classification.Bioinformatics, 30(9):123...
-
[72]
An N-terminal basic tail rich in (K R) that may enhance RNA association
-
[73]
The central KOW-like KNDTVVVLSGDDKGKQGAVLELIPAKKAAIV segment providing the β-barrel structure
-
[74]
A C-terminal helix with conserved (A L)-rich residues to complete the ribosomal protein fold. Connecting these elements yields a plausible full protein sequence, denoted asMGKIRKNDTVVVLSGDDK GKQGAVLELIPAKKAAIVKGVNIKTKHRKPSNKNTSGEIITFEAPILLSKLALVAKKATKDKPAIPTRVGFKIENKKKIRIAKK TGKAI, which meets the length and functional criteria for a KOW-containing riboso...
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.