Pith. sign in

REVIEW

Wide-Field Lensing Mass Maps from DES Science Verification Data

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1505.01871 v2 pith:7L4Z2VLI submitted 2015-05-07 astro-ph.CO

Wide-Field Lensing Mass Maps from DES Science Verification Data

classification astro-ph.CO
keywords massgalaxydarkdatafindidentifiedlensingmaps
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
read the original abstract

We present a mass map reconstructed from weak gravitational lensing shear measurements over 139 sq. deg from the Dark Energy Survey (DES) Science Verification data. The mass map probes both luminous and dark matter, thus providing a tool for studying cosmology. We find good agreement between the mass map and the distribution of massive galaxy clusters identified using a red-sequence cluster finder. Potential candidates for super-clusters and voids are identified using these maps. We measure the cross-correlation between the mass map and a magnitude-limited foreground galaxy sample and find a detection at the 5-7 sigma level on a large range of scales. These measurements are consistent with simulated galaxy catalogs based on LCDM N-body simulations, suggesting low systematics uncertainties in the map. We summarize our key findings in this letter; the detailed methodology and tests for systematics are presented in a companion paper.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.